PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091926.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB
Protein Properties Length: 392aa    MW: 43635.3 Da    PI: 5.8928
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091926.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+  v ++G g+W++++ + g++R++k+c++rw +yl
   XP_010091926.1 14 RGLWTAEEDARLLAHVSKHGFGNWTSVPMKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding47.15.6e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +T++E+e ++++++  G++ W++Ia+ ++ gRt++++k++w++
   XP_010091926.1  69 DFTPQEEEHIINLHQAIGSR-WSLIAKQLP-GRTDNDVKNYWNT 110
                      69******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.404965IPR017930Myb domain
SuperFamilySSF466893.01E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001676.64E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2465116IPR009057Homeodomain-like
SMARTSM007171.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129416.19566116IPR017930Myb domain
PfamPF002491.4E-1368110IPR001005SANT/Myb domain
CDDcd001671.10E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTAE EDARLLAHVS KHGFGNWTSV PMKAGLNRCG KSCRLRWTNY  60
LRPDLNHNDF TPQEEEHIIN LHQAIGSRWS LIAKQLPGRT DNDVKNYWNT KLRKKLSKMG  120
IDPITHKPIS QILSEYGNIS GLVNSGRLHI ASRNTDNVFV PKSEPSSIIT GFLPPTNMIT  180
RPAIEQVPDY DSFSSYNPSL DFLSKSQVIN HDIVQPHFFN EVTSSCSSSS SSSHVSDLIS  240
SPQSLSCQQS QAQIFTHSSS SSSSSSLNWS EFFLKLEEET QEGEQEGDLQ GLVSSTNAVI  300
LSQSETPAQK FRSDQYSANR TVDEELGSHS MSDFESTIFG SQVSNKTENS SADSFLDTLL  360
DRDSKLTAAF PELLDGSFGY YCAYLDDRHF PA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4083250.0KC408325.1 Morus indica microsatellite MSCP180-C sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091926.10.0Transcription repressor
TrEMBLW9QPV90.0W9QPV9_9R
STRINGVIT_14s0066g02180.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-75MYB family protein